PA1314-like (d.17.4.12)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Cystatin-like
Superfamily: NTF2-like
Family: PA1314-like



Orphan Member
 
Domain: d1tp6a_ of protein: Hypothetical protein PA1314 from Species: Pseudomonas aeruginosa [TaxId: 287]




>1tp6a_(d.17.4.12)
CAYRREIHHAHVAIRDWLAGDSRADALDALMARFAEDFSMVTPHGVVLDKTALGELFRSKGGTRPGLRIEIDGESLLASGVDGATLAYREIQSDAAGRSERLSTVVLHRDDEGRLYWRHLQETFCG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)