Atu0742-like (d.17.4.29)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Cystatin-like
Superfamily: NTF2-like
Family: Atu0742-like



Orphan Member
 
Domain: d2k54a1 of protein: Uncharacterized protein Atu0742 from Species: Agrobacterium tumefaciens [TaxId: 358]




>d2k54a1|d.17.4.29
MNSEIELPVQKQLEAYNARDIDAFMAWWADDCQYYAFPATLLAGNAAEIRVRHIERFKEP
DLYGELLTRVIVGNVVIDHETVTRNFPEGKGEVDVACIYEVENGRIAKAWFKIGEPRIVS
QKS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)