SEC-C associated NTF2-like domain (d.17.4.30)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Cystatin-like
Superfamily: NTF2-like
Family: SEC-C associated NTF2-like domain



Orphan Member
 
Domain: d2i9wa1 of protein: Hypothetical protein Psyc2064 from Species: Psychrobacter arcticus [TaxId: 334543]




>d2i9wa1|d.17.4.30
AIRADTAEHLRTRYSAFVLVKPEYIVKTTLPAQQDLLDIKAIENWAKETDWAGLEVVAHT
PKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASWYFLDPTVS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)