AF0587 pre C-terminal domain-like (d.17.6.5)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Cystatin-like
Superfamily: Pre-PUA domain
Family: AF0587 pre C-terminal domain-like



Orphan Member
 
Domain: d2q07a3 of protein: Uncharacterized protein AF0587 from Species: Archaeoglobus fulgidus [TaxId: 2234]




>d2q07a3|d.17.6.5
KVDLYRRILEHLSYQFGITWSGKVAGRYPELELLEGKKRLARVDRIYGLDIYEKIAAYLL
EKNI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)