Transcriptional coactivator PC4 C-terminal domain (d.18.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: ssDNA-binding transcriptional regulator domain
Superfamily: ssDNA-binding transcriptional regulator domain
Family: Transcriptional coactivator PC4 C-terminal domain



Orphan Member
 
Domain: d2pheb1 of protein: Transcriptional coactivator PC4 C-terminal domain from Species: Human (Homo sapiens) [TaxId: 9606]




>2c62b1(d.18.1.1)
AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)