Head-to-tail joining protein W, gpW (d.186.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: gpW/XkdW-like
Superfamily: Head-to-tail joining protein W, gpW
Family: Head-to-tail joining protein W, gpW



Orphan Member
 
Domain: d2l6ra_ of protein: Head-to-tail joining protein W, gpW from Species: Bacteriophage lambda [TaxId: 10710]




>1hywa_(d.186.1.1)
MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)