Chorismate lyase (d.190.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Chorismate lyase-like
Superfamily: Chorismate lyase-like
Family: Chorismate lyase



Orphan Member
 
Domain: d2ahcd_ of protein: Chorismate lyase from Species: Escherichia coli [TaxId: 562]




>1tt8a_(d.190.1.1)
SHPALTQLRALRYSKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLSADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)