DNA-binding C-terminal domain of the transcription factor MotA (d.199.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: MotA C-terminal domain-like
Superfamily: DNA-binding C-terminal domain of the transcription factor MotA
Family: DNA-binding C-terminal domain of the transcription factor MotA



Orphan Member
 
Domain: d1kaff_ of protein: DNA-binding C-terminal domain of the transcription factor MotA from Species: Bacteriophage T4 [TaxId: 10665]




>1kafe_(d.199.1.1)
DMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)