GTP cyclohydrolase I feedback regulatory protein, GFRP (d.205.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily: GTP cyclohydrolase I feedback regulatory protein, GFRP
Family: GTP cyclohydrolase I feedback regulatory protein, GFRP



Orphan Member
 
Domain: d1wplt_ of protein: GTP cyclohydrolase I feedback regulatory protein, GFRP from Species: Norway rat (Rattus norvegicus) [TaxId: 10116]




>1jg5e_(d.205.1.1)
PYLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVNDPPRIVLDKLECRGFRVLSMTGVGQTLVWCLHKE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)