Hypothetical protein MTH1880 (d.214.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Hypothetical protein MTH1880
Superfamily: Hypothetical protein MTH1880
Family: Hypothetical protein MTH1880



Orphan Member
 
Domain: d1iqsa_ of protein: Hypothetical protein MTH1880 from Species: Methanothermobacter thermautotrophicus [TaxId: 145262]




>1iqsa_(d.214.1.1)
LFIATLKGIFTLKDLPEEFRPFVDYKAGLEKKKLSDDDEIAIISIKGTQSNHVLFLSSYNSVDEIRKELEEAGAKINHTTLKILEGHL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)