automated matches (d.215.1.0)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Smc hinge domain
Superfamily: Smc hinge domain
Family: automated matches



Orphan Member
 
Domain: d3l51b_ of protein: automated matches from Species: Mouse (Mus musculus) [TaxId: 10090]




>d3l51b_|d.215.1.0
GKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDIAISSCCHALDYIVVDSIDTAQECVN
FLKKHNIGIATFIGLDKTVWAKKSKIQTPENTPRLFDLVKVKNEEIRQAFYFALRDTLVA
NNLDQATRVAYQRDRRWRVVTLQGQIIEQSGTSGGLEHHHHHH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)