GrpB-like (d.218.1.14)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Nucleotidyltransferase
Superfamily: Nucleotidyltransferase
Family: GrpB-like



Orphan Member
 
Domain: d2nrka1 of protein: Hypothetical protein GrpB from Species: Enterococcus faecalis [TaxId: 1351]




>d2nrka1|d.218.1.14
IVTEYQPAWVEQFEEEAQALKQILKENCLKVEHIGSTSVPNLAAKPIIDFLVIVEEIEKV
DLLQWEFERIGYEYGEFGLSGRRYLRKGPIKRTHHVHIYQFDNTQEILRHLAFRNYLREN
PAIATTYGTLKKQLAQAHPDSIDKYKDAFIKKIEKEALKKYWE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)