Replication modulator SeqA, C-terminal DNA-binding domain (d.228.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Replication modulator SeqA, C-terminal DNA-binding domain
Superfamily: Replication modulator SeqA, C-terminal DNA-binding domain
Family: Replication modulator SeqA, C-terminal DNA-binding domain



Orphan Member
 
Domain: d3sk7b_ of protein: automated matches from Species: Vibrio cholerae [TaxId: 417399]




>1j3ea_(d.228.1.1)
PLGSAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)