At5g01750-like (d.23.1.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Tubby C-terminal domain-like
Superfamily: Tubby C-terminal domain-like
Family: At5g01750-like



Orphan Member
 
Domain: d2q4ma_ of protein: Hypothetical protein At5g01750 from Species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]




>2q4ma1(d.23.1.2)
GGVVVDPKYCAPYPIDMAIVRKDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREDRWQVFRGGSTDQRDLLYTVKRTKLDVFLGHNKDKRCDFRVKGSWLERSCVVYAGESDAIVAQMHRKGKDNFSVTVYPNVDYAFIASLVVILDDVNR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)