D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain (d.230.4.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Dodecin subunit-like
Superfamily: D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain
Family: D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain



Orphan Member
 
Domain: d1xrsb2 of protein: D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain from Species: Clostridium sticklandii [TaxId: 1511]




>1xrsb2(d.230.4.1)
KVQLSFTLPLKNNERSAEAAKQIALKMGLEEPSVVMQQSLDEEFTFFVVYGN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)