DNA-binding protein Tfx (d.236.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: DNA-binding protein Tfx
Superfamily: DNA-binding protein Tfx
Family: DNA-binding protein Tfx



Orphan Member
 
Domain: d1nr3a_ of protein: DNA-binding protein Tfx from Species: Methanobacterium thermoautotrophicum [TaxId: 145262]




>1nr3a_(d.236.1.1)
MRERGWSQKKIARELKTTRQNVSAIERKAMENIEKSRNTLDFVKSLKSPVRILCRRGDTLDEIIKRLLEESNKEGIHVIHDSITLAFLIREKASHRIVHRVVKSDFEIGVTRDGEIIVDLNS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)