Hypothetical protein TM0875 (d.238.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Hypothetical protein TM0875
Superfamily: Hypothetical protein TM0875
Family: Hypothetical protein TM0875



Orphan Member
 
Domain: d1o22a_ of protein: Hypothetical protein TM0875 from Species: Thermotoga maritima [TaxId: 2336]




>1o22a_(d.238.1.1)
ILEILYYKKGKEFGILEKKMKEIFNETGVSLEPVNSELIGRIFLKISVLEEGEEVPSFAIKALTPKENAVDLPLGDWTDLKNVFVEEIDYLDSYGDMKILSEKNWYKIYVPYSSVKKKNRNELVEEFMKYFFESKGWNPGEYTFSVQEI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)