GCM domain (d.239.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: GCM domain
Superfamily: GCM domain
Family: GCM domain



Orphan Member
 
Domain: d1odha_ of protein: Mgcm1 from Species: Mouse (Mus musculus) [TaxId: 10090]




>1odha_(d.239.1.1)
LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMKK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)