GspK pilin-like domain (d.24.1.6)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Pili subunits
Superfamily: Pili subunits
Family: GspK pilin-like domain



Orphan Member
 
Domain: d3ci0k3 of protein: Pseudopilin GspK from Species: Escherichia coli [TaxId: 562]




>d3ci0k3|d.24.1.6
GRTRSQQEYQQALWYSASAESLALSALSLSLKNEKRVHLEQPWASGPRFFPLPQGQIAVT
LRDAQSNYFWLRSDITVNEIELTMNSLIVRMGPQHFSVLWHQTGES

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)