Colicin D nuclease domain (d.243.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Colicin D/E5 nuclease domain
Superfamily: Colicin D/E5 nuclease domain
Family: Colicin D nuclease domain



Orphan Member
 
Domain: d1v74a_ of protein: Colicin D nuclease domain from Species: Escherichia coli [TaxId: 562]




>1v74a_(d.243.1.1)
LNDPLDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)