automated matches (d.248.1.0)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Coproporphyrinogen III oxidase
Superfamily: Coproporphyrinogen III oxidase
Family: automated matches



Orphan Member
 
Domain: d2aexa_ of protein: automated matches from Species: Human (Homo sapiens) [TaxId: 9606]




>d2aexa_|d.248.1.0
EEDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSV
DRWERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPF
CAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHR
TLKEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEVFRFVQSCA
RAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESIL
MSLPLTARWEYMHSPSENSKEAEILEVLRHPRDWVR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)