automated matches (d.25.1.0)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Mitochondrial glycoprotein MAM33-like
Superfamily: Mitochondrial glycoprotein MAM33-like
Family: automated matches



Orphan Member
 
Domain: d3jv1a_ of protein: automated matches from Species: Trypanosome (Trypanosoma brucei) [TaxId: 5691]




>d3jv1a_|d.25.1.0
AVSDQRLSEATLRELEDERQRAGLPEKPEIPEGWTIDRKPGVTHFTMRKSHGDEEIILQL
TGEDRSNEEITRTLDVLVVNGGKALVFGMSVEDGEFVINNVCFRHDGKLALDTSAEAQFQ
KSQLYMGPDLADLEDHLVDSFTSYLSARGVNDTLANFIDQFSLWSEQADYEEWLSSINKF
VS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)