Hypothetical protein TM0160 (d.257.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Hypothetical protein TM0160
Superfamily: Hypothetical protein TM0160
Family: Hypothetical protein TM0160



Orphan Member
 
Domain: d1vjlb_ of protein: Hypothetical protein TM0160 from Species: Thermotoga maritima [TaxId: 2336]




>1vjlb_(d.257.1.1)
HHMRKAWVKTLALDRVSNTPVVILGIEGTNRVLPIWIGACEGHALALAMEKMEFPRPLTHDLLLSVLESLEARVDKVIIHSLKDNTFYATLVIRDLTYEEAALIDIDSRPSDAIILAVKTGAPIFVSDNLVEKHSIEL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)