3-mercaptopyruvate sulfurtransferase, C-terminal domain (d.26.1.3)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: FKBP-like
Superfamily: FKBP-like
Family: 3-mercaptopyruvate sulfurtransferase, C-terminal domain



Orphan Member
 
Domain: d1okga3 of protein: 3-mercaptopyruvate sulfurtransferase, C-terminal domain from Species: Leishmania major [TaxId: 5664]




>1okga3(d.26.1.3)
MCMQMQTPSLGDNPKANLDTMTLKVDGAPCERPDAEVQSAATHLHAGEAATVYFKSGRVVTIEVPVVPNLEA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)