Colicin E3 immunity protein (d.26.2.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: FKBP-like
Superfamily: Colicin E3 immunity protein
Family: Colicin E3 immunity protein



Orphan Member
 
Domain: d3eipb_ of protein: Colicin E3 immunity protein from Species: Escherichia coli [TaxId: 562]




>1e44a_(d.26.2.1)
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)