NinB (d.262.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: NinB
Superfamily: NinB
Family: NinB



Orphan Member
 
Domain: d1pc6b_ of protein: NinB from Species: Bacteriophage lambda [TaxId: 10710]




>1pc6b_(d.262.1.1)
MKKLTFEIRSPAHQQNAIHAVQQILPDPTKPIVVTIQERNRSLDQNRKLWACLGDVSRQVEWHGRWLDAESWKCVFTAALKQQDVVPNLAGNGFVVIGQSTSRMRVGEFAELLELIQAFGTERGVKWSDEARL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)