ParB-like nuclease domain (d.268.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: ParB/Sulfiredoxin
Superfamily: ParB/Sulfiredoxin
Family: ParB-like nuclease domain



Orphan Member
 
Domain: d1vz0h2 of protein: Putative partitioning protein ParB/Spo0J from Species: Thermus thermophilus [TaxId: 274]




>1vz0h2(d.268.1.1)
VVRLPLASIRPNPRQPRKRFAEESLKELADSIREKGLLQPLLVRPQGDGYELVAGERRYRAALMAGLQEVPAVVKDLTDREALELALVENLQR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)