Hypothetical protein PF0899 (d.274.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Hypothetical protein PF0899
Superfamily: Hypothetical protein PF0899
Family: Hypothetical protein PF0899



Orphan Member
 
Domain: d2pk8a_ of protein: Hypothetical protein PF0899 from Species: Pyrococcus furiosus [TaxId: 2261]




>2pk8a1(d.274.1.1)
STRGDLIRILGEIEEKMNELKMDGFNPDIILFGREAYNFLSNLLKKEMEEEGPFTHVSNIKIEILEELGGDAVVIDSKVLGLVPGAAKRIKIIK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)