Hypothetical protein yfbM (d.276.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Hypothetical protein yfbM
Superfamily: Hypothetical protein yfbM
Family: Hypothetical protein yfbM



Orphan Member
 
Domain: d1rylb_ of protein: Hypothetical protein yfbM from Species: Escherichia coli [TaxId: 562]




>1rylb_(d.276.1.1)
MIGYFAEIDSEKINQLLEIHDTLSGLRRLDIDKRWDFLHFGLTGTSAFDPAKNDPLSRAVLGEHSLFLGLTWNQELAATIDRLESLDRNELRKQFSIKRLNEMEIYPGVTFSEELEGQLFASIMLDMEKLISAYRRMLRQGNHALTVIV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)