TaqI C-terminal domain-like (d.287.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: DNA methylase specificity domain
Superfamily: DNA methylase specificity domain
Family: TaqI C-terminal domain-like



Orphan Member
 
Domain: d2np7a2 of protein: DNA methylase TaqI, C-terminal domain from Species: Thermus aquaticus [TaxId: 271]




>2ibtd2(d.287.1.1)
RFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAKELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSSLVQWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPVRREYGFHT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)