GTF2I-like repeat (d.288.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: GTF2I-like repeat
Superfamily: GTF2I-like repeat
Family: GTF2I-like repeat



Orphan Member
 
Domain: d1q60a_ of protein: General transcription factor II-I from Species: Mouse (Mus musculus) [TaxId: 10090]




>1q60a_(d.288.1.1)
GSSGSSGLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESSGPSSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)