YehU-like (d.291.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: YehU-like
Superfamily: YehU-like
Family: YehU-like



Orphan Member
 
Domain: d1y0na_ of protein: Hypothetical UPF0270 protein PA3463 from Species: Pseudomonas aeruginosa [TaxId: 287]




>1y0na_(d.291.1.1)
GHHMLIPHDLLEADTLNNLLEDFVTRETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)