Eukaryotic EndoU ribonuclease (d.294.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: EndoU-like
Superfamily: EndoU-like
Family: Eukaryotic EndoU ribonuclease



Orphan Member
 
Domain: d2c1wc_ of protein: automated matches from Species: African clawed frog (Xenopus laevis) [TaxId: 8355]




>2c1wc1(d.294.1.1)
GQLNHELSKLFNELWDADQNRMKSGKDYRISLQGKAGYVSFPLFQFVDEEKLKSRKTFATFISLLDNYEMDTGVAEVVTPEEIAENNNFLDAILETKVMKMAHDYLVRKNQAKPTRNDFKVQLYNIWFQLYSRAPGSRPDSCGFEHVFVGESKRGQEMMGLHNWVQFYLQEKRKNIDYKGYVARQNKSRPDEDDQVLNLQFNWKEMVKPVGSSFIGVSPEFEFALYTIVFLASQEKMSREVVRLEEYELQIVVNRHGRYIGTAYPVLLSTN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)