TFB5-like (d.295.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: TFB5-like
Superfamily: TFB5-like
Family: TFB5-like



Orphan Member
 
Domain: d2jnjb_ of protein: automated matches from Species: Human (Homo sapiens) [TaxId: 9606]




>1ydla1(d.295.1.1)
KGMLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)