YktB-like (d.296.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: YktB/PF0168-like
Superfamily: YktB/PF0168-like
Family: YktB-like



Orphan Member
 
Domain: d2a8ea1 of protein: Hypothetical protein YktB from Species: Bacillus subtilis [TaxId: 1423]




>2a8ea1(d.296.1.1)
TQMRFTEEDFNTFTIEGLDARMEVLKETVRPKLTALGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWESHVFVWFAIIYESPIKEEYGKLLEVNQETITKNIPDSFVWSADHTKPGVHKQSEMDKEQLKTLFERLQTVKKAELLCGIQLQKEEVLNMNNQEFLQRIDDAFKQLAFLYRLTQKVTQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)