PF0168-like (d.296.1.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: YktB/PF0168-like
Superfamily: YktB/PF0168-like
Family: PF0168-like



Orphan Member
 
Domain: d1yb3a1 of protein: Hypothetical protein PF0168 from Species: Pyrococcus furiosus [TaxId: 2261]




>1yb3a1(d.296.1.2)
MLKEVHELLNRIWGDIFELREELKEELKGFTVEEVSEVFNAYLYIDGKWEEMKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEELSKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVNSDEEMINFEVDLGFDKEEVKREIKRFIELARRYNLL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)