Allophycocyanin linker chain (domain) (d.30.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Allophycocyanin linker chain (domain)
Superfamily: Allophycocyanin linker chain (domain)
Family: Allophycocyanin linker chain (domain)



Orphan Member
 
Domain: d1b33o_ of protein: Allophycocyanin linker chain (domain) from Species: Mastigocladus laminosus [TaxId: 83541]




>1b33o_(d.30.1.1)
GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)