NAP-like (d.305.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: NAP-like
Superfamily: NAP-like
Family: NAP-like



Orphan Member
 
Domain: d2e50q_ of protein: Protein SET from Species: Human (Homo sapiens) [TaxId: 9606]




>2ayua1(d.305.1.1)
IQDRLGSLVGQDSGYVGGLPKNVKEKLLSLKTLQSELFEVEKEFQVEMFELENKFLQKYKPIWEQRSRIISGQEQPKPEQIAKGQEIVESLNETELLVDEEEQVKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYDHAEGCEISWKDNAHNVTVDLEMRKQTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLEERLALDYSIGEQLKDKLIPRAVDWFTGAALEFEFE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)