TM1622-like (d.312.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: TM1622-like
Superfamily: TM1622-like
Family: TM1622-like



Orphan Member
 
Domain: d1vr8a1 of protein: Hypothetical protein TM1622 from Species: Thermotoga maritima [TaxId: 2336]




>1vr8a1(d.312.1.1)
PPEAYSLDTAIFVLETRDYRLSDVKEIDSYGDVEMKGKVAVFETEYGPVFLYVYKGEEAKKIWKKLNGRVSIRSVLDLPNMGKFSTVSNGKKIVAWWRKNWLFIVEGKNGVEEFVKHVYRVYEEMKQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)