Methylmalonyl-CoA epimerase (d.32.1.4)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
Superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
Family: Methylmalonyl-CoA epimerase



Orphan Member
 
Domain: d1jc5f_ of protein: Methylmalonyl-CoA epimerase from Species: Propionibacterium shermanii [TaxId: 1752]




>1jc4b_(d.32.1.4)
EDLFICIDHVAYACPDADEASKYYQETFGWHELHREENPEQGVVEIMMAPAAKLTEHMTQVQVMAPLNDESTVAKWLAKHNGRAGLHHMAWRVDDIDAVSATLRERGVQLLYDEPKLGTGGNRINFMHPKSGKGVLIELTQYPK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)