Hypothetical protein BC1747 (d.32.1.6)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
Superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
Family: Hypothetical protein BC1747



Orphan Member
 
Domain: d1ss4b_ of protein: Hypothetical protein BC1747 from Species: Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]




>1ss4b_(d.32.1.6)
NKLLRMDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEWAGRVTGLGSQCVEIAMMVTPDGHSRIELSRFLTPPTIADHRTAPVNALGYLRVMFTVEDIDEMVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEELG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)