Hypothetical protein At5g48480 (d.32.1.9)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
Superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
Family: Hypothetical protein At5g48480



Orphan Member
 
Domain: d2q48b_ of protein: automated matches from Species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]




>2q48b1(d.32.1.9)
VFTEFKQMLLVEAQKVGDAVTFYKSAFGAIESGHSLHVLSSELNLAGSSFVVCDVSSLPGFSTAKSEGSGVTFLLGTKDAEAAVAKAVDAGAVKVEVTEAEVELGFKGKVTDPFGVTWIFAE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)