Ribosomal protein L28 (d.325.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: L28p-like
Superfamily: L28p-like
Family: Ribosomal protein L28



Orphan Member
 
Domain: d2jz6a1 of protein: Ribosomal protein L28 (L28p) from Species: Thermotoga maritima [TaxId: 2336]




>2j0111(d.325.1.1)
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)