DeoB insert domain-like (d.327.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: DeoB insert domain-like
Superfamily: DeoB insert domain-like
Family: DeoB insert domain-like



Orphan Member
 
Domain: d4n7tb2 of protein: Phosphopentomutase DeoB from Species: Streptococcus mutans [TaxId: 1309]




>2i09b2(d.327.1.1)
FDTFWNGFPEEIISKIEKFSGRKVIREANKPYSGTGELIIYTSADPVLQIAAHEDVIPLDELYRICEYARSITLERPALLGRIIARPYRTANRHDYAL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)