NE0471 N-terminal domain-like (d.331.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: NE0471 N-terminal domain-like
Superfamily: NE0471 N-terminal domain-like
Family: NE0471 N-terminal domain-like



Orphan Member
 
Domain: d2auwb2 of protein: Hypothetical protein NE0471 N-terminal domain from Species: Nitrosomonas europaea [TaxId: 915]




>2auwb2(d.331.1.1)
YFFPKLTAVEALAPYRLRTTWSTGEVLEVDVGDILRKIPDLAPILDPEAFARVHIAEWEGSVEWFDTEFGRDNVYAWAKEQAGE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)