lvD/EDD N-terminal domain-like (d.334.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: IlvD/EDD N-terminal domain-like
Superfamily: IlvD/EDD N-terminal domain-like
Family: lvD/EDD N-terminal domain-like



Orphan Member
 
Domain: d2gp4b2 of protein: 6-phosphogluconate dehydratase EDD from Species: Shewanella oneidensis [TaxId: 70863]




>2gp4b2(d.334.1.1)
MHSVVQSVTDRIIARSKASREAYLAALNDARNHKACQEVGSVAQVAVPCDGVTQGQPGMELSLLSREVIAMATAVGLSHNMFDGALLLGICKIVPGLLIGALSFGHLPMLFVPAGPQLMLEVMGLQLPGSSFVNPDDPLREALNKMAAKQVCRLTELGTQYSPIGEVVNEKSIVNGIVALLATGGSTNLTMHIVAAARAAGIIVNWDDFSELSDAVPLLARVYPNGHADINHFHAAGGMAFLIKELLDAGLLHEDVNTVAGYGLRRYTQEPKLLDGELRWVDGPTVSLDTEVLTSVATPFQNNG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)