CPE0013-like (d.349.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: CPE0013-like
Superfamily: CPE0013-like
Family: CPE0013-like



Orphan Member
 
Domain: d2jova1 of protein: Hypothetical protein CPE0013 from Species: Clostridium perfringens [TaxId: 1502]




>d2jova1|d.349.1.1
MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNI
MNTGVDIICTKNLPKDS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)