YcgL-like (d.350.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: YcgL-like
Superfamily: YcgL-like
Family: YcgL-like



Orphan Member
 
Domain: d2h7aa1 of protein: Hypothetical protein YcgL from Species: Escherichia coli [TaxId: 562]




>d2h7aa1|d.350.1.1
SMPKPGILKSKSMFCVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDG
RKKLVNADIEKVKQALTEQGYYLQLPPPPEDLLKQHLSVMGQKTDDTNK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)