Shew3726-like (d.354.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Shew3726-like
Superfamily: Shew3726-like
Family: Shew3726-like



Orphan Member
 
Domain: d2gpia1 of protein: Hypothetical protein Shew3726 from Species: Shewanella loihica [TaxId: 359303]




>d2gpia1|d.354.1.1
NQSIIFTEQLTWDVQLSAIHFTAQQQGVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFR
FDIEEQAEKLIEQEAFDVQGHIQVERVD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)