The homologous-pairing domain of Rad52 recombinase (d.50.1.3)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: dsRBD-like
Superfamily: dsRNA-binding domain-like
Family: The homologous-pairing domain of Rad52 recombinase



Orphan Member
 
Domain: d1kn0k_ of protein: The homologous-pairing domain of Rad52 recombinase from Species: Human (Homo sapiens) [TaxId: 9606]




>1h2iv_(d.50.1.3)
LCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)